PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa12g014380.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 462aa    MW: 52926.5 Da    PI: 8.8745
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa12g014380.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B355.69.8e-18251031298
                     HTT-EE--HHH.HTT.---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3  12 ksgrlvlpkkfaeeh.ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                     ks ++ +  kf+++h +  k+e+k ++l++ ++  +W++k+      ++++lt+GWkeFv+a++L++gDfvvF++++++ f  +v++f+
  Csa12g014380.1  25 KS-QIKIHVKFFSKHiK-GKQEGKIVKLRSdSWQGTWKIKM------EGHTLTNGWKEFVEAHDLRVGDFVVFRHERDMLF--HVTAFE 103
                     44.59999*******64.44577889998867788888888......7788***********************9998888..888876 PP

2B365.57.8e-21148242299
                     EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
              B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                     f++ +++++l+++ l +p++ a+++g++k ++ +++l++e+g+sWe +++  k++ ++++ +GWk+ + +n+L++gD ++Fkl ++  ++lv+ +
  Csa12g014380.1 148 FSQSVTASNLSRDFLGVPRDVARRYGLDKGRH-EVVLMNEEGKSWESEVKSYKSG-QVFIFGGWKSLCTENRLEVGDPFTFKLLHN-AERLVFLL 239
                     6788999*********************9776.****************655555.555556********************9995.55579999 PP

                     E-S CS
              B3  97 frk 99 
                     +++
  Csa12g014380.1 240 CSR 242
                     987 PP

3B352.59e-17250345196
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE...EEETTE..EEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkl.iyrkksgr..yvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                     f+k + ++++l +g   lp +f++e++++k++   ++l d++  +W +kl +yrk+s++  y+ ++GWk+F+ an++ +g++++++l++  ++++
  Csa12g014380.1 250 FVKLTPTPNSLHLGKQQLPVSFMRENMLDKPG--NIILVDKDKVEWLMKLeCYRKGSRMmmYISSNGWKSFCAANEVGAGESLTLELIR-GGTSP 341
                     7788888899999999***********99877..5***************777888888888888**********************98.55556 PP

                     EEEE CS
              B3  93 vvkv 96 
                     ++++
  Csa12g014380.1 342 LLMF 345
                     6655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.107.1E-249107IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.92E-2110111IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.88513105IPR003340B3 DNA binding domain
CDDcd100171.87E-1614102No hitNo description
SMARTSM010199.5E-2016105IPR003340B3 DNA binding domain
PfamPF023621.3E-1226101IPR003340B3 DNA binding domain
SuperFamilySSF1019361.41E-20141241IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.9E-20142241IPR015300DNA-binding pseudobarrel domain
CDDcd100174.95E-17147241No hitNo description
PROSITE profilePS5086314.565147242IPR003340B3 DNA binding domain
SMARTSM010191.3E-28148243IPR003340B3 DNA binding domain
PfamPF023622.5E-20148242IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.5E-15248347IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.1E-15248345IPR015300DNA-binding pseudobarrel domain
CDDcd100172.34E-14249341No hitNo description
SMARTSM010193.3E-25250349IPR003340B3 DNA binding domain
PfamPF023628.0E-16250346IPR003340B3 DNA binding domain
PROSITE profilePS5086311.956250350IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 462 aa     Download sequence    Send to blast
MENPSSSLFS PKNPHFFQPL LPGFKSQIKI HVKFFSKHIK GKQEGKIVKL RSDSWQGTWK  60
IKMEGHTLTN GWKEFVEAHD LRVGDFVVFR HERDMLFHVT AFEPSCCEVQ YAQSLSHNEI  120
GESSRKEKEI EENVKTEPDL FSSDLTCFSQ SVTASNLSRD FLGVPRDVAR RYGLDKGRHE  180
VVLMNEEGKS WESEVKSYKS GQVFIFGGWK SLCTENRLEV GDPFTFKLLH NAERLVFLLC  240
SRTEAGPNRF VKLTPTPNSL HLGKQQLPVS FMRENMLDKP GNIILVDKDK VEWLMKLECY  300
RKGSRMMMYI SSNGWKSFCA ANEVGAGESL TLELIRGGTS PLLMFVSKME LSPVEAEARP  360
HKRARVQIWS KESERLKHDV RQKIAAEGEP SRRTRSSSKS TGDQENPQHT QSCSILDHLP  420
KVRQSIEETL TSIRRFRAKL ETKEQTLEAL LHEIENYQVM M*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010447526.10.0PREDICTED: B3 domain-containing protein REM8-like isoform X2
SwissprotQ8H2D10.0REM8_ARATH; B3 domain-containing protein REM8
TrEMBLD7MB410.0D7MB41_ARALL; Putative uncharacterized protein
STRINGAT4G31680.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20422261
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31680.10.0B3 family protein